Class b: All beta proteins [48724] (141 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (2 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) |
Protein Acidic FGF (FGF1) [50357] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50359] (23 PDB entries) |
Domain d1nzkd_: 1nzk D: [92381] complexed with fmt, so4; mutant |
PDB Entry: 1nzk (more details), 1.95 Å
SCOP Domain Sequences for d1nzkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzkd_ b.42.1.1 (D:) Acidic FGF (FGF1) {Human (Homo sapiens)} hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkngs vkrgprthygqkailflplpv
Timeline for d1nzkd_: