Lineage for d1nw4c_ (1nw4 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1608177Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1608178Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1608555Protein Putative uridine phosphorylase [102500] (1 species)
  7. 1608556Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102501] (3 PDB entries)
  8. 1608565Domain d1nw4c_: 1nw4 C: [92225]
    complexed with imh, ipa, so4

Details for d1nw4c_

PDB Entry: 1nw4 (more details), 2.2 Å

PDB Description: crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with immh and sulfate
PDB Compounds: (C:) Uridine phosphorylase, putative

SCOPe Domain Sequences for d1nw4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw4c_ c.56.2.1 (C:) Putative uridine phosphorylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

SCOPe Domain Coordinates for d1nw4c_:

Click to download the PDB-style file with coordinates for d1nw4c_.
(The format of our PDB-style files is described here.)

Timeline for d1nw4c_: