Lineage for d1nvga2 (1nvg A:144-313)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 685977Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 685995Protein Alcohol dehydrogenase [51737] (9 species)
  7. 685999Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries)
  8. 686007Domain d1nvga2: 1nvg A:144-313 [92206]
    Other proteins in same PDB: d1nvga1
    complexed with zn; mutant

Details for d1nvga2

PDB Entry: 1nvg (more details), 2.5 Å

PDB Description: n249y mutant of the alcohol dehydrogenase from the archaeon sulfolobus solfataricus-tetragonal crystal form
PDB Compounds: (A:) NAD-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1nvga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvga2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd
vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnysektlsvypkalak
qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk

SCOP Domain Coordinates for d1nvga2:

Click to download the PDB-style file with coordinates for d1nvga2.
(The format of our PDB-style files is described here.)

Timeline for d1nvga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nvga1