Class a: All alpha proteins [46456] (284 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.6: Staphylocoagulase [101094] (1 family) duplication: consists of two domains of this fold |
Family a.8.6.1: Staphylocoagulase [101095] (1 protein) |
Protein Staphylocoagulase [101096] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [101097] (2 PDB entries) |
Domain d1nu9c2: 1nu9 C:146-281 [92201] Other proteins in same PDB: d1nu9a_, d1nu9d_ complexed with 0zj, hg, imd |
PDB Entry: 1nu9 (more details), 2.2 Å
SCOPe Domain Sequences for d1nu9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu9c2 a.8.6.1 (C:146-281) Staphylocoagulase {Staphylococcus aureus [TaxId: 1280]} lkpftdemeekatarvddlankaysvyfafvrdtqhktealelkakvdlvlgdedkphri sneriekemikdlesiiedffietglnkpdnitsydsskhhyknhsegfealvketreav tnandswktktvkkyg
Timeline for d1nu9c2:
View in 3D Domains from other chains: (mouse over for more information) d1nu9a_, d1nu9d_, d1nu9f1, d1nu9f2 |