Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins) N-terminal domain is a 8-bladed beta-propeller automatically mapped to Pfam PF00326 |
Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries) Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487 |
Domain d1nu8b2: 1nu8 B:509-766 [92198] Other proteins in same PDB: d1nu8a1, d1nu8b1 complexed with nag |
PDB Entry: 1nu8 (more details), 2.5 Å
SCOPe Domain Sequences for d1nu8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu8b2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d1nu8b2: