SCOPe 2.08: Domain d1nu1j_: 1nu1 J:

Lineage for d1nu1j_ (1nu1 J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
   Uniprot P00130

8. Domain d1nu1j_: 1nu1 J: [92181]
   Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1k_
   complexed with fes, hem, qno

Details for d1nu1j_

PDB Entry: 1nu1, 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d1nu1j_:

Sequence; same for both SEQRES and ATOM records:

>d1nu1j_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
n

Timeline for d1nu1j_:

• d1nu1j_ first appeared in SCOP 1.67
  
• d1nu1j_ appears in SCOPe 2.07