Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 2 [63409] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries) Uniprot P23004 |
Domain d1nu1b2: 1nu1 B:236-439 [92170] Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_ complexed with fes, hem, qno |
PDB Entry: 1nu1 (more details), 3.2 Å
SCOPe Domain Sequences for d1nu1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu1b2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak kfvsgrksmaasgnlghtpfidel
Timeline for d1nu1b2: