![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) ![]() location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
![]() | Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
![]() | Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries) Uniprot P00129 |
![]() | Domain d1ntzf_: 1ntz F: [92159] Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_ complexed with fes, hem, uq2 |
PDB Entry: 1ntz (more details), 2.6 Å
SCOPe Domain Sequences for d1ntzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntzf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
Timeline for d1ntzf_: