Lineage for d1ntmi_ (1ntm I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005102Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3005103Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 3005124Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 3005125Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 3005126Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 3005134Domain d1ntmi_: 1ntm I: [92134]
    Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmj_, d1ntmk_
    complexed with fes, hem

Details for d1ntmi_

PDB Entry: 1ntm (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom
PDB Compounds: (I:) ubiquinol-cytochrome c reductase 8 kda protein

SCOPe Domain Sequences for d1ntmi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntmi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOPe Domain Coordinates for d1ntmi_:

Click to download the PDB-style file with coordinates for d1ntmi_.
(The format of our PDB-style files is described here.)

Timeline for d1ntmi_: