Lineage for d1ntkc1 (1ntk C:261-379)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580258Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2580259Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2580260Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2580261Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 2580283Species Cow (Bos taurus) [TaxId:9913] [81643] (18 PDB entries)
    Uniprot P00157
  8. 2580299Domain d1ntkc1: 1ntk C:261-379 [92109]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntkc1

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1ntkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d1ntkc1:

Click to download the PDB-style file with coordinates for d1ntkc1.
(The format of our PDB-style files is described here.)

Timeline for d1ntkc1: