Lineage for d1nofa2 (1nof A:44-320)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439737Protein Glycosyl hydrolase family 5 xylanase, catalytic domain [102073] (1 species)
    overall domain organization is similar to the homologous glucosylceramidase
  7. 2439738Species Erwinia chrysanthemi [TaxId:556] [102074] (2 PDB entries)
  8. 2439740Domain d1nofa2: 1nof A:44-320 [92021]
    Other proteins in same PDB: d1nofa1
    complexed with act

Details for d1nofa2

PDB Entry: 1nof (more details), 1.42 Å

PDB Description: the first crystallographic structure of a xylanase from glycosyl hydrolase family 5: implications for catalysis
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1nofa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]}
iqgfggmsgvgwindltteqintaygsgvgqiglsimrvridpdsskwniqlpsarqavs
lgakimatpwsppaymksnnslinggrllpanysaytshlldfskymqtngaplyaisiq
nepdwkpdyescewsgdefksylksqgskfgslkvivaeslgfnpaltdpvlkdsdasky
vsiigghlygttpkpyplaqnagkqlwmtehyvdskqsannwtsaievgtelnasmvsny
sayvwwyirrsyglltedgkvskrgyvmsqyarfvrp

SCOPe Domain Coordinates for d1nofa2:

Click to download the PDB-style file with coordinates for d1nofa2.
(The format of our PDB-style files is described here.)

Timeline for d1nofa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nofa1