SCOP 1.67: Domain d1nofa1: 1nof A:31-43,A:321-413

Lineage for d1nofa1 (1nof A:31-43,A:321-413)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Glycosyl hydrolase family 5 xylanase [101922] (1 species)

7. Species Erwinia chrysanthemi [TaxId:556] [101923] (1 PDB entry)

8. Domain d1nofa1: 1nof A:31-43,A:321-413 [92020]
   Other proteins in same PDB: d1nofa2
   complexed with act

Details for d1nofa1

PDB Entry: 1nof, 1.42 Å

PDB Description: the first crystallographic structure of a xylanase from glycosyl hydrolase family 5: implications for catalysis

SCOP Domain Sequences for d1nofa1:

Sequence; same for both SEQRES and ATOM records:

>d1nofa1 b.71.1.2 (A:31-43,A:321-413) Glycosyl hydrolase family 5 xylanase {Erwinia chrysanthemi}
dtvkidanvnyqiXgalriqatenpqsnvhltaykntdgkmvivavntndsdqmlslnis
nanvtkfekystsaslnveyggssqvdssgkatvwlnplsvttfvsk

Timeline for d1nofa1:

• d1nofa1 is new in SCOP 1.67
  
• d1nofa1 appears in SCOP 1.69
  
• d1nofa1 appears in the current release, SCOPe 2.08