Lineage for d1nl0h1 (1nl0 H:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739899Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2739907Domain d1nl0h1: 1nl0 H:1-113 [91945]
    Other proteins in same PDB: d1nl0g_, d1nl0h2, d1nl0l1, d1nl0l2
    part of Fab 10c12 against factor IX Gla domain
    complexed with ca, so4

Details for d1nl0h1

PDB Entry: 1nl0 (more details), 2.2 Å

PDB Description: Crystal structure of human factor IX Gla domain in complex of an inhibitory antibody, 10C12
PDB Compounds: (H:) anti-factor IX antibody, 10C12, chain H

SCOPe Domain Sequences for d1nl0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl0h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
gvqlvesgggvvqpgrslrlscaasgftfstyamhwvrqapgkglewvaiisydgskkyy
adsvkgrftisrdnskntlylqmnslraedtavyycarasiaaarvldywgrgtmvtvss

SCOPe Domain Coordinates for d1nl0h1:

Click to download the PDB-style file with coordinates for d1nl0h1.
(The format of our PDB-style files is described here.)

Timeline for d1nl0h1: