SCOP 1.75: Domain d1ndjd_: 1ndj D:

Lineage for d1ndjd_ (1ndj D:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1ndjd_: 1ndj D: [91821]
   complexed with btn; mutant

Details for d1ndjd_

PDB Entry: 1ndj, 1.81 Å

PDB Description: streptavidin mutant y43f with biotin at 1.81a resolution

PDB Compounds: (D:) streptavidin

SCOP Domain Sequences for d1ndjd_:

Sequence; same for both SEQRES and ATOM records:

>d1ndjd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtfesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk

Timeline for d1ndjd_:

• d1ndjd_ first appeared in SCOP 1.67
  
• d1ndjd_ appears in SCOP 1.73
  
• d1ndjd_ appears in SCOPe 2.01
  
• d1ndjd_ appears in the current release, SCOPe 2.08