Lineage for d1n9yb_ (1n9y B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1552677Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1552700Protein Streptavidin [50878] (1 species)
  7. 1552701Species Streptomyces avidinii [TaxId:1895] [50879] (123 PDB entries)
  8. 1552761Domain d1n9yb_: 1n9y B: [91739]
    complexed with mpd, mrd; mutant

Details for d1n9yb_

PDB Entry: 1n9y (more details), 1.53 Å

PDB Description: streptavidin mutant s27a at 1.5a resolution
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1n9yb_:

Sequence, based on SEQRES records: (download)

>d1n9yb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

Sequence, based on observed residues (ATOM records): (download)

>d1n9yb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgatfivtagadgaltgtyesnaesryvltgrydsapatdgsgtalgwt
vawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

SCOPe Domain Coordinates for d1n9yb_:

Click to download the PDB-style file with coordinates for d1n9yb_.
(The format of our PDB-style files is described here.)

Timeline for d1n9yb_: