SCOP 1.73: Domain d1n9gc1: 1n9g C:23-160,C:350-386

Lineage for d1n9gc1 (1n9g C:23-160,C:350-386)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meander
Superfamily b.35.1: GroES-like [50129] (2 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein 2,4-dienoyl-CoA reductase [89309] (1 species)
Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries)
Domain d1n9gc1: 1n9g C:23-160,C:350-386 [91724]
Other proteins in same PDB: d1n9ga2, d1n9gb2, d1n9gc2, d1n9gd2, d1n9ge2, d1n9gf2

Details for d1n9gc1

PDB Entry: 1n9g (more details), 1.98 Å

PDB Description: mitochondrial 2-enoyl thioester reductase etr1p/etr2p heterodimer from candida tropicalis

PDB Compounds: (C:) 2,4-dienoyl-CoA reductase

SCOP Domain Sequences for d1n9gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9gc1 b.35.1.2 (C:23-160,C:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

SCOP Domain Coordinates for d1n9gc1:

Click to download the PDB-style file with coordinates for d1n9gc1.
(The format of our PDB-style files is described here.)

Timeline for d1n9gc1: