Lineage for d1n7yb_ (1n7y B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2806107Domain d1n7yb_: 1n7y B: [91700]
    mutant

Details for d1n7yb_

PDB Entry: 1n7y (more details), 1.96 Å

PDB Description: streptavidin mutant n23e at 1.96a
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1n7yb_:

Sequence, based on SEQRES records: (download)

>d1n7yb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwyeqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1n7yb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwyeqlgstfivtagadgaltgtyenaesryvltgrydsapatdgsgtalgwtvaw
knnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1n7yb_:

Click to download the PDB-style file with coordinates for d1n7yb_.
(The format of our PDB-style files is described here.)

Timeline for d1n7yb_: