Lineage for d1n27a1 (1n27 A:8-90)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394294Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2394307Protein Hepatoma-derived growth factor, related protein 3 [101684] (1 species)
  7. 2394308Species Mouse (Mus musculus) [TaxId:10090] [101685] (1 PDB entry)
  8. 2394309Domain d1n27a1: 1n27 A:8-90 [91549]
    Other proteins in same PDB: d1n27a2, d1n27a3

Details for d1n27a1

PDB Entry: 1n27 (more details)

PDB Description: solution structure of the pwwp domain of mouse hepatoma-derived growth factor, related protein 3
PDB Compounds: (A:) Hepatoma-derived growth factor, related protein 3

SCOPe Domain Sequences for d1n27a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n27a1 b.34.9.2 (A:8-90) Hepatoma-derived growth factor, related protein 3 {Mouse (Mus musculus) [TaxId: 10090]}
eykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpkdlfpyke
ykdkfgksnkrkgfneglweien

SCOPe Domain Coordinates for d1n27a1:

Click to download the PDB-style file with coordinates for d1n27a1.
(The format of our PDB-style files is described here.)

Timeline for d1n27a1: