SCOPe 2.08: Domain d1mvub_: 1mvu B:

Lineage for d1mvub_ (1mvu B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1mvub_: 1mvu B: [91475]
   Other proteins in same PDB: d1mvua_
   part of P-glycoprotein-specific scFv C219; complexed with synthetic epitope peptide, chain P
   complexed with so4; mutant

Details for d1mvub_

PDB Entry: 1mvu, 1.78 Å

PDB Description: single chain fv of c219 heavy chain v101l mutant in complex with synthetic epitope peptide

PDB Compounds: (B:) Ig VDJ-region (HEAVY CHAIN)

SCOPe Domain Sequences for d1mvub_:

Sequence; same for both SEQRES and ATOM records:

>d1mvub_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrelysyyspldvwgagttvtvp
s

Timeline for d1mvub_:

• d1mvub_ first appeared in SCOP 1.67
  
• d1mvub_ appears in SCOPe 2.07