SCOPe 2.07: Domain d1mqng_: 1mqn G:

Lineage for d1mqng_ (1mqn G:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (19 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)

8. Domain d1mqng_: 1mqn G: [91416]
   Other proteins in same PDB: d1mqnb_, d1mqne_, d1mqnh_
   complexed with gal, nag, sia

Details for d1mqng_

PDB Entry: 1mqn, 3.2 Å

PDB Description: bha/lstc

PDB Compounds: (G:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d1mqng_:

Sequence; same for both SEQRES and ATOM records:

>d1mqng_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpek

Timeline for d1mqng_:

• d1mqng_ first appeared in SCOP 1.67
  
• d1mqng_ appears in SCOPe 2.06
  
• d1mqng_ appears in the current release, SCOPe 2.08