Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries) |
Domain d1m05a2: 1m05 A:1-181 [91157] Other proteins in same PDB: d1m05a1, d1m05b_, d1m05c1, d1m05d_ complexed with cd |
PDB Entry: 1m05 (more details), 1.9 Å
SCOPe Domain Sequences for d1m05a2:
Sequence, based on SEQRES records: (download)
>d1m05a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]} gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle r
>d1m05a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]} gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaapwieqegpeywdrntqifk tntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydgkdyialne dlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtler
Timeline for d1m05a2:
View in 3D Domains from other chains: (mouse over for more information) d1m05b_, d1m05c1, d1m05c2, d1m05d_ |