Class b: All beta proteins [48724] (165 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (2 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
Species Pseudomonas aeruginosa [TaxId:287] [101702] (1 PDB entry) |
Domain d1lluh1: 1llu H:2-143,H:310-342 [91078] Other proteins in same PDB: d1llua2, d1llub2, d1lluc2, d1llud2, d1llue2, d1lluf2, d1llug2, d1lluh2 complexed with edo, nad, zn |
PDB Entry: 1llu (more details), 2.3 Å
SCOP Domain Sequences for d1lluh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lluh1 b.35.1.2 (H:2-143,H:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys vnggyaeyvladpnyvgilpknXvkatihpgklddinqildqmragqiegrivlem
Timeline for d1lluh1: