Lineage for d1l2ga_ (1l2g A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546549Protein HSV glycoprotein D [63637] (1 species)
  7. 546550Species Herpes simplex virus type 1 [TaxId:10298] [63638] (2 PDB entries)
    elaborated with insertions and N- and C-terminal extensions
  8. 546552Domain d1l2ga_: 1l2g A: [91048]

Details for d1l2ga_

PDB Entry: 1l2g (more details), 2.85 Å

PDB Description: structure of a c-terminally truncated form of glycoprotein d from hsv- 1

SCOP Domain Sequences for d1l2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ga_ b.1.1.1 (A:) HSV glycoprotein D {Herpes simplex virus type 1}
pnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyyavleracrsvllna
pseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsynkslgacpirtqp
rwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfilehrakgsckyal
plrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiagwhgpkapytstll
pp

SCOP Domain Coordinates for d1l2ga_:

Click to download the PDB-style file with coordinates for d1l2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ga_: