SCOPe 2.08: Domain d1j05h_: 1j05 H:

Lineage for d1j05h_ (1j05 H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1j05h_: 1j05 H: [90737]
   Other proteins in same PDB: d1j05a_, d1j05l_
   part of anti-CEA Fv T84.66
   complexed with gol, po4

Details for d1j05h_

PDB Entry: 1j05, 1.5 Å

PDB Description: The crystal structure of anti-carcinoembryonic antigen monoclonal antibody T84.66 Fv fragment

PDB Compounds: (H:) anti-CEA mAb T84.66, heavy chain

SCOPe Domain Sequences for d1j05h_:

Sequence; same for both SEQRES and ATOM records:

>d1j05h_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnsky
vpkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvs
s

Timeline for d1j05h_:

• d1j05h_ first appeared in SCOP 1.67
  
• d1j05h_ appears in SCOPe 2.07