Lineage for d1hkka1 (1hkk A:22-266,A:335-385)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) 
Family c.1.8.5: Type II chitinase [51534] (14 proteins)
glycosylase family 18
Protein Chitotriosidase [82251] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82252] (8 PDB entries) 
Domain d1hkka1: 1hkk A:22-266,A:335-385 [90634]
Other proteins in same PDB: d1hkka2
Details for d1hkka1
PDB Entry: 1hkk (more details), 1.85 Å
PDB Description: high resoultion crystal structure of human chitinase in complex with allosamidin
SCOP Domain Sequences for d1hkka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkka1 c.1.8.5 (A:22-266,A:335-385) Chitotriosidase {Human (Homo sapiens)}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeqsgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqel
SCOP Domain Coordinates for d1hkka1:
Click to download the PDB-style file with coordinates for d1hkka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hkka1:
- d1hkka1 first appeared in SCOP 1.67
- d1hkka1 appears in SCOP 1.71
- d1hkka1 appears in the current release, SCOPe 2.08
View in 3D
