SCOP 1.67: Domain d1h3ga2: 1h3g A:518-600

Lineage for d1h3ga2 (1h3g A:518-600)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclomaltodextrinase [101917] (1 species)
   protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains

7. Species Flavobacterium sp. 92 [TaxId:197856] [101918] (1 PDB entry)

8. Domain d1h3ga2: 1h3g A:518-600 [90595]
   Other proteins in same PDB: d1h3ga1, d1h3ga3, d1h3gb1, d1h3gb3

Details for d1h3ga2

PDB Entry: 1h3g, 2.1 Å

PDB Description: cyclomaltodextrinase from flavobacterium sp. no. 92: from dna sequence to protein structure

SCOP Domain Sequences for d1h3ga2:

Sequence; same for both SEQRES and ATOM records:

>d1h3ga2 b.71.1.1 (A:518-600) Cyclomaltodextrinase {Flavobacterium sp. 92}
rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv
glgrelrlapksvvvielpglpe

Timeline for d1h3ga2:

• d1h3ga2 is new in SCOP 1.67
  
• d1h3ga2 appears in SCOP 1.69
  
• d1h3ga2 appears in the current release, SCOPe 2.08