Lineage for d1hg5a2 (1hg5 A:19-149)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 543124Superfamily a.118.9: ENTH/VHS domain [48464] (4 families) (S)
  5. 543172Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins)
  6. 543177Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100912] (1 species)
  7. 543178Species Rat (Rattus norvegicus) [TaxId:10116] [100913] (4 PDB entries)
  8. 543182Domain d1hg5a2: 1hg5 A:19-149 [90361]
    Other proteins in same PDB: d1hg5a1
    complexed with ihp

Details for d1hg5a2

PDB Entry: 1hg5 (more details), 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex

SCOP Domain Sequences for d1hg5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg5a2 a.118.9.3 (A:19-149) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
rqvafdftkvk

SCOP Domain Coordinates for d1hg5a2:

Click to download the PDB-style file with coordinates for d1hg5a2.
(The format of our PDB-style files is described here.)

Timeline for d1hg5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hg5a1