Lineage for d1pvoe1 (1pvo E:1-47)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506479Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 1506522Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 1506523Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
    automatically mapped to Pfam PF07498
  6. 1506524Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 1506525Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
    Uniprot P03002
  8. 1506541Domain d1pvoe1: 1pvo E:1-47 [88327]
    Other proteins in same PDB: d1pvoa2, d1pvoa3, d1pvob1, d1pvob2, d1pvoc2, d1pvoc3, d1pvod2, d1pvod3, d1pvoe2, d1pvoe3, d1pvof2, d1pvof3
    protein/RNA complex; complexed with anp

Details for d1pvoe1

PDB Entry: 1pvo (more details), 3 Å

PDB Description: x-ray crystal structure of rho transcription termination factor in complex with ssrna substrate and anppnp
PDB Compounds: (E:) transcription termination factor rho

SCOPe Domain Sequences for d1pvoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvoe1 a.140.3.1 (E:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOPe Domain Coordinates for d1pvoe1:

Click to download the PDB-style file with coordinates for d1pvoe1.
(The format of our PDB-style files is described here.)

Timeline for d1pvoe1: