![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (11 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein Actin interacting protein 1 [89378] (2 species) 14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89380] (2 PDB entries) |
![]() | Domain d1pi6a1: 1pi6 A:2-326 [88115] complexed with zn |
PDB Entry: 1pi6 (more details), 2.5 Å
SCOPe Domain Sequences for d1pi6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pi6a1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqftg hgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpisd iswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvgd dgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksgef lkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnqq vgvvatgngriislsldgtlnfyel
Timeline for d1pi6a1: