SCOP 1.75: Domain d1p9mc2: 1p9m C:196-296

Lineage for d1p9mc2 (1p9m C:196-296)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries)

8. Domain d1p9mc2: 1p9m C:196-296 [87996]
   Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_

Details for d1p9mc2

PDB Entry: 1p9m, 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex

PDB Compounds: (C:) Interleukin-6 receptor alpha chain

SCOP Domain Sequences for d1p9mc2:

Sequence; same for both SEQRES and ATOM records:

>d1p9mc2 b.1.2.1 (C:196-296) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhcvihdawsglrhvvqlraqeefgqgewsewspeamgtpw

Timeline for d1p9mc2:

• d1p9mc2 first appeared in SCOP 1.65
  
• d1p9mc2 appears in SCOP 1.73
  
• d1p9mc2 appears in SCOPe 2.01
  
• d1p9mc2 appears in the current release, SCOPe 2.08