Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries) |
Domain d1p9mc2: 1p9m C:196-296 [87996] Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_ |
PDB Entry: 1p9m (more details), 3.65 Å
SCOP Domain Sequences for d1p9mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9mc2 b.1.2.1 (C:196-296) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq hhcvihdawsglrhvvqlraqeefgqgewsewspeamgtpw
Timeline for d1p9mc2:
View in 3D Domains from other chains: (mouse over for more information) d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_ |