Lineage for d1p9mc2 (1p9m C:196-296)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762034Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)
  7. 2762035Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries)
  8. 2762043Domain d1p9mc2: 1p9m C:196-296 [87996]
    Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_

Details for d1p9mc2

PDB Entry: 1p9m (more details), 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex
PDB Compounds: (C:) Interleukin-6 receptor alpha chain

SCOPe Domain Sequences for d1p9mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9mc2 b.1.2.1 (C:196-296) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhcvihdawsglrhvvqlraqeefgqgewsewspeamgtpw

SCOPe Domain Coordinates for d1p9mc2:

Click to download the PDB-style file with coordinates for d1p9mc2.
(The format of our PDB-style files is described here.)

Timeline for d1p9mc2: