Lineage for d1p84h_ (1p84 H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025949Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 3025950Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 3025951Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 3025952Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (10 PDB entries)
  8. 3025960Domain d1p84h_: 1p84 H: [87862]
    Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84i_, d1p84j_, d1p84k_
    complexed with 3pe, 3ph, cdl, dbt, fes, hec, pc1, umq, uq6

Details for d1p84h_

PDB Entry: 1p84 (more details), 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex
PDB Compounds: (H:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1p84h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p84h_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

SCOPe Domain Coordinates for d1p84h_:

Click to download the PDB-style file with coordinates for d1p84h_.
(The format of our PDB-style files is described here.)

Timeline for d1p84h_: