Lineage for d1p84c1 (1p84 C:262-385)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (5 PDB entries)
  8. Domain d1p84c1: 1p84 C:262-385 [87854]
    Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_
    complexed with 3pe, 3ph, cdl, dbt, fes, hec, pc1, umq, uq6

Details for d1p84c1

PDB Entry: 1p84 (more details), 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1p84c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p84c1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOPe Domain Coordinates for d1p84c1 are not available.

Timeline for d1p84c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p84c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_