Lineage for d1p1rc1 (1p1r C:1-163,C:340-374)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538001Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1538002Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1538123Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1538141Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1538158Species Horse (Equus caballus) [TaxId:9796] [50138] (40 PDB entries)
    Uniprot P00327
  8. 1538185Domain d1p1rc1: 1p1r C:1-163,C:340-374 [87707]
    Other proteins in same PDB: d1p1ra2, d1p1rb2, d1p1rc2, d1p1rd2
    complexed with mpd, nai, nmh, zn

Details for d1p1rc1

PDB Entry: 1p1r (more details), 1.57 Å

PDB Description: Horse liver alcohol dehydrogenase complexed with NADH and R-N-1-methylhexylformamide
PDB Compounds: (C:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d1p1rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1rc1 b.35.1.2 (C:1-163,C:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d1p1rc1:

Click to download the PDB-style file with coordinates for d1p1rc1.
(The format of our PDB-style files is described here.)

Timeline for d1p1rc1: