Lineage for d1p0ca2 (1p0c A:1164-1337)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576365Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 1576383Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1576395Species Frog (Rana perezi) [TaxId:8403] [89511] (2 PDB entries)
  8. 1576398Domain d1p0ca2: 1p0c A:1164-1337 [87639]
    Other proteins in same PDB: d1p0ca1, d1p0cb1
    complexed with gol, po4, zn

Details for d1p0ca2

PDB Entry: 1p0c (more details), 2.2 Å

PDB Description: Crystal Structure of the NADP(H)-Dependent Vertebrate Alcohol Dehydrogenase (ADH8)
PDB Compounds: (A:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1p0ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0ca2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}
aplescligcgfatgygaavntakvtpgstcavfglggvgfsaivgckaagasriigvgt
hkdkfpkaielgateclnpkdydkpiyevicektnggvdyavecagrietmmnalqstyc
gsgvtvvlglaspnerlpldplllltgrslkgsvfggfkgeevsrlvddymkkk

SCOPe Domain Coordinates for d1p0ca2:

Click to download the PDB-style file with coordinates for d1p0ca2.
(The format of our PDB-style files is described here.)

Timeline for d1p0ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p0ca1