Lineage for d1oyjb2 (1oyj B:3-85)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1601322Protein Class tau GST [81365] (2 species)
  7. 1601327Species Rice (Oryza sativa) [TaxId:4530] [89706] (1 PDB entry)
  8. 1601329Domain d1oyjb2: 1oyj B:3-85 [87600]
    Other proteins in same PDB: d1oyja1, d1oyjb1, d1oyjc1, d1oyjd1
    complexed with cl, gol, gsh, mg

Details for d1oyjb2

PDB Entry: 1oyj (more details), 1.95 Å

PDB Description: Crystal structure solution of Rice GST1 (OsGSTU1) in complex with glutathione.
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1oyjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyjb2 c.47.1.5 (B:3-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}
eekelvlldfwvspfgqrcriamaekglefeyreedlgnksdlllrsnpvhrkipvllha
grpvseslvilqylddafpgtph

SCOPe Domain Coordinates for d1oyjb2:

Click to download the PDB-style file with coordinates for d1oyjb2.
(The format of our PDB-style files is described here.)

Timeline for d1oyjb2: