Lineage for d1oy3c_ (1oy3 C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 367735Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 367758Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 367769Species Mouse (Mus musculus) [TaxId:10090] [49254] (10 PDB entries)
  8. 367773Domain d1oy3c_: 1oy3 C: [87553]
    Other proteins in same PDB: d1oy3d_

Details for d1oy3c_

PDB Entry: 1oy3 (more details), 2.05 Å

PDB Description: crystal structure of an ikbbeta/nf-kb p65 homodimer complex

SCOP Domain Sequences for d1oy3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oy3c_ b.1.18.1 (C:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)}
taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetfk
simkkspfngptepr

SCOP Domain Coordinates for d1oy3c_:

Click to download the PDB-style file with coordinates for d1oy3c_.
(The format of our PDB-style files is described here.)

Timeline for d1oy3c_: