Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins) subgroup of the larger IPT/TIG domain family |
Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49254] (10 PDB entries) |
Domain d1oy3c_: 1oy3 C: [87553] Other proteins in same PDB: d1oy3d_ |
PDB Entry: 1oy3 (more details), 2.05 Å
SCOP Domain Sequences for d1oy3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy3c_ b.1.18.1 (C:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)} taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetfk simkkspfngptepr
Timeline for d1oy3c_: