Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (3 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (3 proteins) probably stems out from the biMOP domain |
Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89336] (5 PDB entries) |
Domain d1oxvd1: 1oxv D:243-353 [87537] Other proteins in same PDB: d1oxva2, d1oxvb2, d1oxvd2 complexed with anp, iod, mg |
PDB Entry: 1oxv (more details), 1.95 Å
SCOP Domain Sequences for d1oxvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxvd1 b.40.6.3 (D:243-353) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfekn
Timeline for d1oxvd1:
View in 3D Domains from other chains: (mouse over for more information) d1oxva1, d1oxva2, d1oxvb1, d1oxvb2 |