Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89682] (5 PDB entries) |
Domain d1oxva2: 1oxv A:1-242 [87534] Other proteins in same PDB: d1oxva1, d1oxvb1, d1oxvd1 |
PDB Entry: 1oxv (more details), 1.95 Å
SCOP Domain Sequences for d1oxva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxva2 c.37.1.12 (A:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr veevakildihhvlnhfprelsggqqqrvalaralvkdpslllldepfsnldarmrdsar alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl ig
Timeline for d1oxva2:
View in 3D Domains from other chains: (mouse over for more information) d1oxvb1, d1oxvb2, d1oxvd1, d1oxvd2 |