Lineage for d1oxtd2 (1oxt D:1-242)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831595Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 831674Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species)
  7. 831675Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89682] (5 PDB entries)
  8. 831686Domain d1oxtd2: 1oxt D:1-242 [87526]
    Other proteins in same PDB: d1oxta1, d1oxtb1, d1oxtd1

Details for d1oxtd2

PDB Entry: 1oxt (more details), 2.1 Å

PDB Description: Crystal structure of GlcV, the ABC-ATPase of the glucose ABC transporter from Sulfolobus solfataricus
PDB Compounds: (D:) ABC transporter, ATP binding protein

SCOP Domain Sequences for d1oxtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxtd2 c.37.1.12 (D:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg
elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr
veevakildihhvlnhfprelsggqqqrvalaralvkdpslllldepfsnldarmrdsar
alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl
ig

SCOP Domain Coordinates for d1oxtd2:

Click to download the PDB-style file with coordinates for d1oxtd2.
(The format of our PDB-style files is described here.)

Timeline for d1oxtd2: