Lineage for d1ou5b1 (1ou5 B:151-354)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
    multihelical; can be divided into three subdomains (neck, body and tail)
  4. Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) (S)
    the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like
  5. Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
    the 'neck' domain corresponds to the C-terminal part of Pfam PF01743
  6. Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)
  7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [89128] (1 PDB entry)
  8. Domain d1ou5b1: 1ou5 B:151-354 [87447]
    Other proteins in same PDB: d1ou5a2, d1ou5a3, d1ou5b2, d1ou5b3
    the tail subdomain is not present in this structure
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1ou5b1

PDB Entry: 1ou5 (more details), 3.4 Å

PDB Description: crystal structure of human cca-adding enzyme
PDB Compounds: (B:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1ou5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou5b1 a.173.1.1 (B:151-354) tRNA CCA-adding enzyme, C-terminal domains {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
kvrfvghakqriqedylrilryfrfygrivdkpgdhdpetleaiaenakglagisgeriw
velkkilvgnhvnhlihliydldvapyiglpanasleefdkvsknvdgfspkpvtllasl
fkvqddvtkldlrlkiakeeknlglfivknrkdlikatdssdplkpyqdfiidsrepdat
trvcellkyqgehcllkemqqwsi

SCOPe Domain Coordinates for d1ou5b1 are not available.

Timeline for d1ou5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ou5b2, d1ou5b3
View in 3D
Domains from other chains:
(mouse over for more information)
d1ou5a1, d1ou5a2, d1ou5a3