Lineage for d1ot2a1 (1ot2 A:496-581)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658718Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 658719Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 658725Domain d1ot2a1: 1ot2 A:496-581 [87396]
    Other proteins in same PDB: d1ot2a2, d1ot2a3, d1ot2a4
    complexed with acy, ca, epe, glc, mal, mpd; mutant

Details for d1ot2a1

PDB Entry: 1ot2 (more details), 2.1 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant d135n
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOP Domain Sequences for d1ot2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ot2a1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1ot2a1:

Click to download the PDB-style file with coordinates for d1ot2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ot2a1: