![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries) |
![]() | Domain d1ot1a2: 1ot1 A:582-686 [87393] Other proteins in same PDB: d1ot1a1, d1ot1a3, d1ot1a4 complexed with acy, ca, epe, mpd; mutant |
PDB Entry: 1ot1 (more details), 2 Å
SCOPe Domain Sequences for d1ot1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ot1a2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]} lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1ot1a2: