Class g: Small proteins [56992] (66 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulphide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (2 families) |
Family g.24.1.2: BAFF receptor-like [90174] (2 proteins) only fragments of the receptor structures are available; no domain division is provided here |
Protein Tumor necrosis factor receptor superfamily member 17, BCMA [90177] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90178] (1 PDB entry) |
Domain d1oqdl_: 1oqd L: [87279] Other proteins in same PDB: d1oqda_, d1oqdb_, d1oqdc_, d1oqdd_, d1oqde_, d1oqdf_, d1oqdg_, d1oqdh_, d1oqdi_, d1oqdj_ |
PDB Entry: 1oqd (more details), 2.6 Å
SCOP Domain Sequences for d1oqdl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqdl_ g.24.1.2 (L:) Tumor necrosis factor receptor superfamily member 17, BCMA {Human (Homo sapiens)} csqneyfdsllhacipcqlrcssntppltcqrycnasvt
Timeline for d1oqdl_: