SCOP 1.65: Domain d1opxa_: 1opx A:

Lineage for d1opxa_ (1opx A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Hexameric traffic ATPase, HP0525 [52719] (1 species)
   includes N-terminal alpha+beta domain of a profilin-like topology

7. Species Helicobacter pylori [TaxId:210] [52720] (4 PDB entries)

8. Domain d1opxa_: 1opx A: [87243]

Details for d1opxa_

PDB Entry: 1opx, 2.8 Å

PDB Description: Crystal structure of the traffic ATPase (HP0525) of the Helicobacter pylori type IV secretion system bound by sulfate

SCOP Domain Sequences for d1opxa_:

Sequence; same for both SEQRES and ATOM records:

>d1opxa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori}
lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
fkdlidmivhinhhkqcdefyik

Timeline for d1opxa_:

• d1opxa_ is new in SCOP 1.65
  
• d1opxa_ appears in SCOP 1.67
  
• d1opxa_ appears in the current release, SCOPe 2.08