Lineage for d1onpb3 (1onp B:126-274)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606790Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 606791Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 606792Species Escherichia coli [TaxId:562] [69771] (10 PDB entries)
  8. 606808Domain d1onpb3: 1onp B:126-274 [87170]
    Other proteins in same PDB: d1onpa1, d1onpa2, d1onpb1, d1onpb2
    complexed with fom, mw1

Details for d1onpb3

PDB Entry: 1onp (more details), 2.5 Å

PDB Description: IspC complex with Mn2+ and fosmidomycin

SCOP Domain Sequences for d1onpb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onpb3 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

SCOP Domain Coordinates for d1onpb3:

Click to download the PDB-style file with coordinates for d1onpb3.
(The format of our PDB-style files is described here.)

Timeline for d1onpb3: