Lineage for d1ondq_ (1ond Q:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648287Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 2648354Domain d1ondq_: 1ond Q: [87139]
    complexed with troleandomycin macrolide antibiotic
    protein/RNA complex; complexed with tao

Details for d1ondq_

PDB Entry: 1ond (more details), 3.4 Å

PDB Description: the crystal structure of the 50s large ribosomal subunit from deinococcus radiodurans complexed with troleandomycin macrolide antibiotic
PDB Compounds: (Q:) 50S ribosomal protein L22

SCOPe Domain Sequences for d1ondq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ondq_ i.1.1.2 (Q:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
tiivaekgnk

SCOPe Domain Coordinates for d1ondq_:

Click to download the PDB-style file with coordinates for d1ondq_.
(The format of our PDB-style files is described here.)

Timeline for d1ondq_: