SCOPe 2.08: Domain d1omja2: 1omj A:3-244

Lineage for d1omja2 (1omj A:3-244)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (8 PDB entries)
   psychrophilic alkaline protease

8. Domain d1omja2: 1omj A:3-244 [87084]
   Other proteins in same PDB: d1omja1
   complexed with ca, so4, zn

Details for d1omja2

PDB Entry: 1omj, 2.38 Å

PDB Description: crystal structure of a psychrophilic alkaline protease from pseudomonas tac ii 18

PDB Compounds: (A:) serralysin

SCOPe Domain Sequences for d1omja2:

Sequence, based on SEQRES records:

>d1omja2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd
ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl
yg

Sequence, based on observed residues (ATOM records):

>d1omja2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd
ynptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg

Timeline for d1omja2:

• d1omja2 first appeared in SCOP 1.65
  
• d1omja2 appears in SCOPe 2.07