Lineage for d1ofub2 (1ofu B:209-317)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565737Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2565782Species Pseudomonas aeruginosa [TaxId:287] [89982] (2 PDB entries)
  8. 2565784Domain d1ofub2: 1ofu B:209-317 [86975]
    Other proteins in same PDB: d1ofua1, d1ofub1, d1ofux_, d1ofuy_
    complexed with SulA homologue PA3008
    complexed with gdp

Details for d1ofub2

PDB Entry: 1ofu (more details), 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d1ofub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofub2 d.79.2.1 (B:209-317) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
vdfadvktvmsemgmammgtgcasgpnrareateaairnplledvnlqgargilvnitag
pdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvtvvatglg

SCOPe Domain Coordinates for d1ofub2:

Click to download the PDB-style file with coordinates for d1ofub2.
(The format of our PDB-style files is described here.)

Timeline for d1ofub2: