Lineage for d1ofea1 (1ofe A:1240-1507)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302910Fold b.80: Single-stranded right-handed beta-helix [51125] (5 superfamilies)
    superhelix with each turn made by 3 strands with short links
    duplication: turns of the helix are structural repeats
  4. 303021Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) (S)
  5. 303022Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
    this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain
  6. 303023Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 303027Species Synechocystis sp. [TaxId:1143] [75027] (5 PDB entries)
  8. 303030Domain d1ofea1: 1ofe A:1240-1507 [86941]
    Other proteins in same PDB: d1ofea2, d1ofea3, d1ofeb2, d1ofeb3

Details for d1ofea1

PDB Entry: 1ofe (more details), 2.45 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate and l-don at 2.45 angstrom resolution

SCOP Domain Sequences for d1ofea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofea1 b.80.4.1 (A:1240-1507) Alpha subunit of glutamate synthase, C-terminal domain {Synechocystis sp.}
vhsngpvldddiladpdiqeainhqttatktyrlvntdrtvgtrlsgaiakkygnngfeg
nitlnfqgaagqsfgafnldgmtlhlqgeandyvgkgmnggeivivphpqasfapednvi
igntclygatggnlyangragerfavrnsvgkaviegagdhcceymtggvivvlgpvgrn
vgagmtgglayfldevgdlpekinpeiitlqritaskgeeqlkslitahvehtgspkgka
ilanwsdylgkfwqavppsekdspeann

SCOP Domain Coordinates for d1ofea1:

Click to download the PDB-style file with coordinates for d1ofea1.
(The format of our PDB-style files is described here.)

Timeline for d1ofea1: